Team

W1siziisijiwmtgvmdyvmtmvmdkvmtivmjuvntawl0fkyw0gtwfyc2gglsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Adam Marsh,Chief Executive Officer

Husband, father and serial entrepreneur, I am fortunate to have found my three greatest passions in life. Although balancing them all daily can be a challenge, especially considering the hectic workload and travel schedule which can average around 75 flights and 15 countries a year. As a family we opted to reside in Southern Spain, where the chi...

W1siziisijiwmtgvmdyvmtmvmtavmdkvmdcvndk1l01pa2ugugv0cmllic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Michael Petrie,Chief Commercial Officer

I knew when we brought together TechStream Group’s board of directors that we would be designing & building a truly unique business and one that would hopefully disrupt and transform classical recruitment models across some very exciting engineering and technology markets. Having worked with all the board members previously meant there was an im...

W1siziisijiwmtgvmdyvmtmvmdkvntevntivodc3l0jyzxr0ie1hcnnoic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Brett Marsh,Managing Partner - North America

Having over 15 years of global talent acquisition experience, I have been privileged to have lived and travelled international throughout my career. Originally residing in the UK and providing technology recruitment into financial markets, I subsequently spent 9 years living & recruiting cutting edge technologists across Asia. As part of TechStr...

W1siziisijiwmtgvmdyvmdyvmdgvmdkvmjgvmtkyl1zpyybezsbgzw8glsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Vic De Feo,Managing Partner - UK & Europe

I started off my professional life as an electronics engineer focussed on testing mission critical avionics and radar systems...somewhat different to where I am today. My experiences have been diverse and am fortunate that these have all had a positive impact on my career and for me as a person I’ve led a high-profile delivery and outsourced pro...

W1siziisijiwmtgvmdyvmdyvmdcvmdgvmtqvotixl01pbgvziexpdhrszsatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Miles Little,Managing Partner - UK & Europe

I joined the CloudStream with over 30 years of technology experience, from engineering the early internet with companies such as Cisco Systems all the way to building out recent agile technology services companies. I’ve always been a pure technologist and was constantly motivated by the rapid change of technology development and connectivity in ...

W1siziisijiwmtgvmdyvmjuvmdgvmdivmjmvodg4l1n0dwfydcbib2xtyw4glsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Stuart Holman,Managing Partner - UK & Europe

Having over 27 years of global experience in strategic growth & leadership roles for global recruitment and consulting companies; I have amassed a wealth of knowledge that I bring to our clients; always assuring talent solutions meet their technology demands and create genuine return on investment. Having worked with all the board members on a p...

W1siziisijiwmtgvmdyvmtmvmtqvmdivmjyvnzi4l1j5yw4grm9yymvzic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Ryan Forbes,Managing Partner - MEA

As a Managing Partner within the TechStream Group and one of the groups founding team members I have been involved in building our business from the ground floor up. Building a new business is challenging; it takes time, drive, commitment and there are many highs and lows along the way. However, once you really start to see the success of what y...

W1siziisijiwmtgvmdyvmjuvmdcvntkvntqvotmzl1ryyw9sywnoie1jq2fizsatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Traolach McCabe,Managing Partner - UK & Europe

I have amassed over 25 years’ consulting and programme management experience, focused predominately across the financial services sector and spending much of this time in investment banking, wealth management & corporate and retail banking. The projects I have worked across have been very varied but always have technology, change and regulations...

W1siziisijiwmtgvmdyvmdyvmdgvmdgvmzcvmzqzl1dpbgxpyw0gvhj1enppluzyyw5jb25pic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

William Truzzi-Franconi,Managing Partner - UK & Europe

I have over 18 years’ staffing and project management experience within the Financial Services sector, I started my career in investment banking for UBS where I supported the businesses resourcing requirements for front, middle and back office functions. Over the years I’ve delivered similar projects for other investment banks, wealth management...

W1siziisijiwmtgvmdcvmzevmtivmzuvmjcvnzi1l0fuzhjldybeb2rkic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Andrew Dodd,Managing Partner - APAC

Having worked with EarthStream for several years I was very excited when asked to enlarge my role and become Managing Partner for TechStream Group’s Asia Business. Based in Singapore “SMART nation” we have become a melting-pot of cultures, full of youth, with an insatiable appetite for technology. As a key global growth centre, the region never ...

W1siziisijiwmtgvmdyvmdyvmdcvmtavndqvnji1l0thbmcgu2hpayblaw0glsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Kim Kang,Client Services Director

I’m Kim, a loving husband, avid poker player, F1 fanatic and Head of CloudStreams’ Flexible Talent Solutions Practice in the UK. With 12 years of specialisation in Prime Services, Hedge Funds and Derivative IT, I have recruited across all levels from: CTO, Programme Management, Project managers, BA’s and technical resources. My experience of wor...

W1siziisijiwmtgvmdcvmzevmtivndmvmzcvnzk2l0jlbibeyxzpcyatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Ben Davis,Talent Director

I’m Ben; a father of three beautiful children an avid Gloucester Rugby fan and head of CloudStream’s Permanent Talent Solutions Practice in the UK. With over 13 years of technical recruitment experience supporting large international transformation projects, I have developed a client and candidate style that is forward thinking, and delivery ori...

W1siziisijiwmtgvmdyvmdqvmtqvntevmjavmzazl0xlcybej1npbhzhic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Les D'Silva,Client Services Director

Financial Technology recruitment has been my passion for over 25 years and during this time I have seen many changes: dotcom bubbles rise and burst, a Y2K that never was, multiple recessions and multiple rebounds. But one thing has stayed firm – the best businesses need the best talent whatever the market conditions. What I love is to see most a...

W1siziisijiwmtgvmdyvmtmvmtmvndgvntivntg1l1j5yw4grm9yymvzic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Andrew Clark,Talent Director

I’m Andrew and about 9 years ago I relocated from UK to South Africa, one of the best decisions I ever made. During the summer I’ll head to the beach, in the winter it’s up to the wine farms, in between there’s plenty of hikes and climbs, restaurants and bars and a multitude of other activities to keep you busy outside of work. The social aspect...

W1siziisijiwmtgvmduvmzevmtavmjcvmjivnzuyl0rpbm8gtmfpciattmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Dino Nair,Talent Director

During the week you will know me as Dino, CloudStreams Resource Director, but on the International 9-ball pool circuit you will know me as “Dynamite”. I’ve competed in the world championships, represented South Africa on a number of occasions and am a WPA (World Pool Association) committee member. Fortunately, my work has meant I have lived in b...

W1siziisijiwmtgvmdcvmzevmtivndevmtcvodc3l1ryaxb0asbezxzszwtlciatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Tripti Devleker,Talent Director

I’m Tripti, an experienced SMAC expert recruiter with an MBA in Marketing & Human Resources. After completing my MBA in 2005, I decided to utilise my technical, marketing and human resource knowledge and embark on a career in talent services. I felt my impact can be twofold: first, you can literally change the life of an individual by placing th...

W1siziisijiwmtgvmdyvmdyvmdgvmdmvmjmvmti2l0pvzsbfbnr3axnszsatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Joe Entwisle,Talent Director

Since graduating from university, I have lived and recruited in three different countries UK, Spain and South Africa. In each location having the opportunity to build an amazing network, develop my skill base and have a myriad of life experiences. Being based in Cape Town gives you easy access to the entire African region and some of the fastest...

W1siziisijiwmtgvmduvmzevmtavmzevmtkvmjy5l0nocmlzie1jq2fizsatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Chris McCabe,Talent Director

Throughout my career I’ve lived and recruited across three continents Europe, Asia and Africa, building an amazing global network of friends, colleagues and clients. One of my core attributes has been the ability to build flexible resource practices from the ground floor upwards and this is my goal with CloudStream. I’ve spent over 5 years in Ho...

W1siziisijiwmtgvmdyvmtmvmtmvntqvmdivodaxl1jvbmfuifrpzxjuzxkgic0gtmv3lmpwzwcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Ronan Tierney,Talent Manager

I’m Ronan, one of CloudStream’s Talent Solutions Managers; originating from Ireland I have had the privilege of living and recruiting in several locations around the world including Ireland, Australia, Singapore and now Spain. Throughout my 10-year career, I have been fortunate enough to have been involved in some large-scale project recruitment...

W1siziisijiwmtgvmdyvmtmvmtuvmdkvmzmvmzg1l0fudg9pbmv0dgugqiatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Antoinette Buckle,Talent Principal

I’m Antoinette or “Anti” to the office and a self-confessed fitness enthusiast borderline fanatic. When I’m not in the office, I’m in the gym training or instructing, my day begins around 4:30 so I’m ready to take my 1st class before work and then into the office. It’s a brutal but rewarding regime. I really enjoy having a positive impact on peo...

W1siziisijiwmtgvmduvmzevmdkvmzkvmtevmzmzl0xhd3jlbmnlienvecatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Lawrence Cox,Talent Principal

Although originally from Cape Town, I relocated to London almost 12 years ago and love living in such a dynamic and vibrant city. As Europe’s leading tech hub and home to some of the hottest start-ups on the planet, it is definitely an exciting place to be for tech recruitment. My focus is on App Dev and over the past 6 years I have helped many ...

W1siziisijiwmtgvmdkvmtivmdyvntuvndivntiwl1bhdwwgqm9zbwfuic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Paul Bosman,Talent Principal

Upon completing my postgraduate degree in Entrepreneurship at the University of Cape Town, I had the enviable opportunity to spend 2 amazing years as crew for private luxury yachts traveling between US & Mediterranean. What a time and what an adventure, but at some point, you must start the serious business of building your career. It was at thi...

W1siziisijiwmtgvmdyvmtmvmtqvmdevntcvndq1l0jyawfuienyaw1taw5zic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Brian Crimmins,Talent Manager

In 2008, after 10 years of Engineering & Technology recruitment across the Irish market, I decided to relocate to Spain and take on a broader geographical remit focusing my skills on the rest of Europe and Middle East. Little did I know I would also meet my now wife, raise a family and discover (become addicted to) golf. Moving to Spain and imme...

W1siziisijiwmtgvmduvmzevmtevmtevmdivnjqwl1ntaxroifn0zxzlic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Steve Smith,Talent Manager

I’m now into my 13th year in recruitment and my passion for working with organisations to deliver talented people still grows every day. I’m fortunate to have had a diverse and rewarding career within both global and SME recruitment businesses, and these days I enjoy being deployed on the business side - working directly with cutting-edge organi...

W1siziisijiwmtgvmdyvmdyvmdcvmjuvmjavmjy0l1zpa3rvcmlqysbcywxhy2hvdmljic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Viktorija Balachovic,Client Service Relationship Manager

I have a very unique background, as prior to recruitment I spent over 10 years as a professional snowboarder and was being sponsored by some top logos. Eventually there is a decision to make continue on the snow boarder path or begin a longer-term career path. I choose the later and decided to move to the City of London where I can put my passio...

W1siziisijiwmtgvmdyvmdyvmdcvmtqvmzkvnzi1l0noyxjsawugsmlua3mglsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Charlie Jinks,Client Services Consultant

Before I began my career in talent acquisition I was in the British Pole-vaulting team, and yes on the face of it they seem worlds apart and you would be right; but once you look at the core attributes drive, determination, team work, focus and discipline the only real difference is a big pole! These are the attributes that I feel have allowed m...

W1siziisijiwmtgvmdyvmjuvmdgvmdyvmzuvntqvqw5nawugdmfuifz1dxjlbiatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Angeline Van Vuuren,Talent Principle

After graduating with my BA Law degree from the University of Johannesburg, I began a career in law registering my articles at a commercial property firm; thereafter venturing to the UAE for a short stint gaining some experience in legal practice management abroad, which I thoroughly enjoyed. Coming home to SA with some wiser & clearer insight i...

W1siziisijiwmtgvmduvmzevmtavmdivmjivndg0l1rhbwfyifzhbibezxigtwvyd2uglsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Tamar Van Der Merwe,Key Accounts Consultant

I am Tamar, a Capetonian at heart, with a love of nature- and hiking in particular. Outside the red brick walls of our Cloudstream offices, I also enjoy exploring the local wine culture, beaches and getting lost in a good book. After graduating with an Honours in English, I travelled to South Korea, where I spent a year teaching English and inte...

W1siziisijiwmtgvmdyvmdyvmdcvmzuvndevody0l0x1y2lhbibty2hyb2vkzxiglsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Lucian Schroeder,Key Accounts Consultant

In a previous life, I was an SEO Link builder, spending my day finding new ways for websites to rank in searches for various keywords. When the opportunity presented for me to move into technology recruitment I jumped at the chance. CloudStream in South Africa is seen as the market leading technology provider and this was the ideal place to begi...

W1siziisijiwmtgvmdyvmdqvmtmvntgvmtivotqxl1zpd2ugu2liyxjhic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Viwe Sibhara,Key Accounts Consultant

Being born and bred in the lovely, once small, village of Hout Bay in Cape Town with the ocean, mountains and tall trees around me, I wanted to learn how people shaped the world. With the cliché of “money makes the world go around”, I embarked on a journey to learn about economics and the world of finance, however crunching numbers and learning ...

W1siziisijiwmtgvmdyvmjuvmdgvmtavmtcvnda5l1rhbgvzagegdmfuigrlcibmaw5kzsatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Talesha-Cherie van der Linde,Key Accounts Consultant

Born in South Africa but wanting to see the world, I set off and began my career in India. I worked there for 12 months in hospitality before moving onto a new culture and city that I fell in love with – Dubai and continued within the hospitality industry. When the opportunity to join CloudStream in South Africa and embark on a new career in rec...

W1siziisijiwmtgvmdyvmdqvmtmvntevntavmtkvu2hhdw5uysbdyw1wagvyic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Shaunna Campher,Key Accounts Consultant

Originally from London, I relocated to South Africa 8 years ago, and now call Cape Town my home. I enjoy exploring far-flung places and camping in the middle of no-where; luckily, the Western Cape offers lots of opportunities for exactly this. When I’m not working or camping, I’m usually in my veggie garden with my two Wire Fox Terriers (Daisy a...

W1siziisijiwmtgvmdyvmdyvmdcvmtkvntkvmjg5l0hvbmv5iehhc3nhbiatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Honey Hassan,Client Services Consultant

I’m Honey, a spoken word poet and a fitness enthusiast. A lot of my free time is spent either at the gym or performing at spoken word competitions- spaces which I can explore the limits of both mind and body. This natural affiliation with performance led me towards a career in recruitment. It gave me the perfect opportunity to constantly interac...

W1siziisijiwmtgvmduvmzevmtavmzuvmzivmzg4l01hdhrozxcgu2nob2xtcyatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Matthew Schloms,Talent Consultant

Coming from a sales background I had the pleasure of working with people from various cultural background and always delivering exceptional service. I love developing new business opportunities and interacting with clients and candidates. My role at CloudStream allows me to blend everything I love in a career from one of the most beautiful citie...

W1siziisijiwmtgvmdyvmdyvmdcvndevmzyvndi2l1bldhj1cybxzxnzzwxzic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Petrus Wessels,Talent Consultant

Like many in South Africa, I grew up in a rural region (where it is said even the birds fly upside down because there is nothing to see for miles). I knew from an early age that I would move to a big city like Cape Town, where it bends the city life style with gorgeous landscape of mountains, beaches and vineyards. Based in our trendy red brick ...

W1siziisijiwmtgvmdyvmtmvmtuvmtevmzmvnjczl0jyb25lifjhbsatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Broné Ram,Talent Consultant

What is more gratifying than getting rewarded for hard work? Getting rewarded for smart work. I have always been a believer of this motif, of course this doesn’t mean I’m quick to shy away from hard-work but rather I look for ways to create systems that will shorten the amount of time actions take whilst increasing the quality of delivery, howev...

W1siziisijiwmtgvmdyvmjuvmdgvmtmvmzmvmjy2l0dlcm55ierlcmtzic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Gerny Derks,Talent Consultant

My friends, clients and candidates call me “Gernz”, I’ve always been a people person, and this was a major reason for embarking on a career in recruitment. I joined CloudStream at the entry level supporting a variety of projects until I began to discover my technical focus and subject matter vertical. It was clear I had a natural affinity with t...

W1siziisijiwmtgvmdyvmjuvmdgvmtuvmjmvodk4l0npyxjyywkgsgvhbgv5ic0gtmv3lmpwzyjdlfsiccisinrodw1iiiwimjgwedi4mfx1mdazyyjdxq

Ciarrai Healy,Talent Consultant

Born and bred in Ireland, it was here I completed my degree and embarked on a career in technology recruitment. I spent many years working in a mix on offsite and onsite roles, always focused on technology and mostly within the outsourcing arena. For several years I worked inhouse for one of the largest global outsourcing companies; I felt durin...

W1siziisijiwmtgvmdyvmdyvmdgvmdcvndqvmjezl01vagftbwfkiethbghvcm8glsbozxcuanbnil0swyjwiiwidgh1bwiilciyodb4mjgwxhuwmdnjil1d

Mohammed Kalhoro,Talent Consultant

I’m Mohammad or Moh – Operations Manager in the UK office, covering HR, Finance and Systems areas to make sure that everything runs as smoothly as possible. My journey here has been an interesting one, after finishing university with a degree in Engineering Management, spending a year in The Forensic Science Service in London and following that ...

W1siziisijiwmtgvmdyvmjuvmdgvmdgvmtkvnty2l0nhewxlzsbeuiatie5ldy5qcgcixsxbinailcj0ahvtyiisiji4mhgyodbcdtawm2mixv0

Caylee de Ricquebourg,Talent Acquisition Manager

Having the opportunity to join such an exciting new talent provider as TechStream and then design their global talent attraction program was a challenge I couldn’t pass up. Since I completed my HR Degree at University of Stellenbosch in 2012, I have been involved in the staffing sector. I initially began as a technology recruiter servicing niche...